DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and ACBP2

DIOPT Version :10

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_194507.1 Gene:ACBP2 / 828891 AraportID:AT4G27780 Length:354 Species:Arabidopsis thaliana


Alignment Length:94 Identity:24/94 - (25%)
Similarity:42/94 - (44%) Gaps:17/94 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EAAELAKNFS----------------KKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMY 54
            |:.||.:.||                |.|:|.: .:.|||:|.||.|.....:|..|.:..:|.:
plant   100 ESTELDEAFSAATLFVTTAAADRLSQKVPSDVQ-QQLYGLYKIATEGPCTAPQPSALKMTARAKW 163

  Fly    55 EAWNAHKGLSKDAAKEAYVKVYEKYAPKY 83
            :||.....:..:.|.|.|:::..:..|.:
plant   164 QAWQKLGAMPPEEAMEKYIEIVTQLYPTW 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..84 CDD:469667 24/94 (26%)
ACBP2NP_194507.1 ACBP 105..185 CDD:459982 20/80 (25%)
ANKYR <230..>338 CDD:440430
ANK repeat 236..263 CDD:293786
ANK repeat 265..296 CDD:293786
ANK repeat 298..329 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.