DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and Acbd7

DIOPT Version :9

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_084339.1 Gene:Acbd7 / 78245 MGIID:1925495 Length:88 Species:Mus musculus


Alignment Length:80 Identity:38/80 - (47%)
Similarity:53/80 - (66%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDAA 68
            |::||:..:....:|.|.|..|.|||:||:.:||:||..|.:||||.||.:||||..|||||:.|
Mouse     7 FDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIACPAMLDLKGKAKWEAWNLQKGLSKEDA 71

  Fly    69 KEAYV----KVYEKY 79
            ..||:    ::.|||
Mouse    72 MCAYISKARELIEKY 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..81 CDD:395715 38/80 (48%)
Acbd7NP_084339.1 ACBP 3..87 CDD:381873 38/80 (48%)
Acyl-CoA binding. /evidence=ECO:0000250 30..34 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101568
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.