powered by:
Protein Alignment Acbp4 and Acbd4
DIOPT Version :9
Sequence 1: | NP_648081.1 |
Gene: | Acbp4 / 38781 |
FlyBaseID: | FBgn0035742 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_080264.1 |
Gene: | Acbd4 / 67131 |
MGIID: | 1914381 |
Length: | 329 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 26/73 - (35%) |
Similarity: | 40/73 - (54%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 LAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDAAKEAYVK 74
|.||.|.:|:..|.|.||..:||||:|...:.:||..|...:..::|||....:|::.|..||:.
Mouse 24 LPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNRLGKMSREEAMSAYIS 88
Fly 75 VYEKYAPK 82
..:..|.|
Mouse 89 EMKLVAQK 96
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp4 | NP_648081.1 |
ACBP |
4..81 |
CDD:395715 |
24/70 (34%) |
Acbd4 | NP_080264.1 |
ACBP |
11..91 |
CDD:279259 |
24/66 (36%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.