DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and ACBD7

DIOPT Version :9

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001034933.1 Gene:ACBD7 / 414149 HGNCID:17715 Length:88 Species:Homo sapiens


Alignment Length:80 Identity:40/80 - (50%)
Similarity:51/80 - (63%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDAA 68
            |:.|||..:....:|.|.|..|.|||:|||.|||:||..||:||||.||.:||||..||||.:.|
Human     7 FDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDA 71

  Fly    69 KEAYVKVYEKYAPKY 83
            ..||:...::...||
Human    72 TSAYISKAKELIEKY 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..81 CDD:395715 38/76 (50%)
ACBD7NP_001034933.1 ACBP 3..87 CDD:320831 40/80 (50%)
Acyl-CoA binding 30..34 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101568
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.