DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and acbd4

DIOPT Version :10

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_998260.1 Gene:acbd4 / 406368 ZFINID:ZDB-GENE-040426-2074 Length:403 Species:Danio rerio


Alignment Length:81 Identity:30/81 - (37%)
Similarity:43/81 - (53%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEAAE----LAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLS 64
            |:.|.:    |.||.:.||:....|.||||||||..|...:.:||..|...:..:|||:....:|
Zfish    16 FQAAVDVIQSLPKNGTYKPSYEVMLRFYGLFKQAVCGPCTLSRPGFWDPVGRYKWEAWSNLGEMS 80

  Fly    65 KDAAKEAYVKVYEKYA 80
            ::.|..|||...:|.|
Zfish    81 RETAMAAYVDEMKKVA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..84 CDD:469667 30/81 (37%)
acbd4NP_998260.1 ACBP 13..90 CDD:459982 27/73 (37%)

Return to query results.
Submit another query.