DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and dbi

DIOPT Version :9

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_988874.1 Gene:dbi / 394469 XenbaseID:XB-GENE-6453954 Length:87 Species:Xenopus tropicalis


Alignment Length:81 Identity:39/81 - (48%)
Similarity:52/81 - (64%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDA 67
            :|::|||..|.....|||.|.||.|.|:||||||||:..:||:||.|.||.:::|...:|.||:.
 Frog     5 AFDKAAEEVKQLKSTPTDEEMLETYALYKQATVGDVDTARPGMLDFKGKAKWDSWKKKEGTSKED 69

  Fly    68 AKEAYVKVYEKYAPKY 83
            |:..||...||...||
 Frog    70 ARAQYVDWVEKLKAKY 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..81 CDD:395715 37/76 (49%)
dbiNP_988874.1 ACBP 2..86 CDD:412233 39/81 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.