DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and Acbp2

DIOPT Version :9

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster


Alignment Length:86 Identity:46/86 - (53%)
Similarity:59/86 - (68%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVS--FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGL 63
            |||  |..|||..|:.:|:|:|.|||:.|.|||||:|||.:..|||:||||.||.:||||..||.
  Fly     1 MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGK 65

  Fly    64 SKDAAKEAYVKVYEKYAPKYA 84
            |.:||::.|:...|....|||
  Fly    66 SSEAAQQEYITFVEGLVAKYA 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..81 CDD:395715 40/76 (53%)
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 43/83 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2339
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D131319at33392
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - otm3578
orthoMCL 1 0.900 - - OOG6_101568
Panther 1 1.100 - - P PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.