DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and CG8814

DIOPT Version :9

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster


Alignment Length:83 Identity:34/83 - (40%)
Similarity:50/83 - (60%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSFEEAAELAKNFSK--------KPTDSEFLEFYGLFKQATVGDVNID-KPGILDLKKKAMYEA 56
            |.:.||..:.|.|..|        :|:.|..|:|||||||||.|..::| |||..|:..||.::|
  Fly     1 MAAIEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQA 65

  Fly    57 WNAHKGLSKDAAKEAYVK 74
            ||.::.|:|:.|.:.||:
  Fly    66 WNDNRHLTKEEAMQRYVE 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..81 CDD:395715 33/80 (41%)
CG8814NP_608729.1 ACBP 5..90 CDD:279259 33/79 (42%)
DUF1664 <217..272 CDD:285172
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.