DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acbp4 and acbd6

DIOPT Version :9

Sequence 1:	NP_648081.1	Gene:	Acbp4 / 38781	FlyBaseID:	FBgn0035742	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	NP_001020626.1	Gene:	acbd6 / 324090	ZFINID:	ZDB-GENE-030131-2810	Length:	300	Species:	Danio rerio

Alignment Length:	79	Identity:	23/79 - (29%)
Similarity:	36/79 - (45%)	Gaps:	0/79 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDAA 68
            ||.||:..::..:..:..:.|..|..|||..||..|..|||..|.:.:..:.||.....:|.:.|
Zfish    64 FESAADRVRDLVQTASREQLLYLYARFKQVKVGKCNTSKPGFFDFEGQRKWSAWKQLGDMSAEQA 128

  Fly    69 KEAYVKVYEKYAPK 82
            .:.||.......|:
Zfish   129 MQEYVTCVHALDPE 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acbp4	NP_648081.1	ACBP	4..81	CDD:395715	22/76 (29%)
acbd6	NP_001020626.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..43
		ACBP	61..141	CDD:279259	22/76 (29%)
		Acyl-CoA binding. /evidence=ECO:0000250	87..91		1/3 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	142..162		0/1 (0%)
		ANK	183..279	CDD:238125
		Ank_2	184..273	CDD:289560
		ANK repeat	209..240	CDD:293786
		ANK 1	209..238
		ANK repeat	242..273	CDD:293786
		ANK 2	242..271
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	270..300
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4281
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810