DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and Eci2

DIOPT Version :10

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001006967.1 Gene:Eci2 / 291075 RGDID:1359427 Length:391 Species:Rattus norvegicus


Alignment Length:70 Identity:29/70 - (41%)
Similarity:38/70 - (54%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDAA 68
            ||.|....|...|.|.:...|..|.|:||||.|...:.|||:.|...||.::||||...|.|:.|
  Rat    41 FENAMNQVKLLKKDPGNEVKLRLYALYKQATEGPCTMPKPGVFDFVNKAKWDAWNALGSLPKETA 105

  Fly    69 KEAYV 73
            ::.||
  Rat   106 RQNYV 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..84 CDD:469667 29/70 (41%)
Eci2NP_001006967.1 ACBP 38..113 CDD:459982 29/70 (41%)
crotonase-like 134..389 CDD:474030
ECH-like 149..319
Microbody targeting signal. /evidence=ECO:0000255 389..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.