DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and Acbd6

DIOPT Version :10

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001011906.1 Gene:Acbd6 / 289125 RGDID:1305030 Length:282 Species:Rattus norvegicus


Alignment Length:78 Identity:25/78 - (32%)
Similarity:37/78 - (47%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDAA 68
            ||:||...:...:..:..:.|..|..:||..||:.||.||...|.:.|..:|||.|....|...|
  Rat    46 FEKAAAHVQGLVQVASREQLLYLYARYKQVKVGNCNIPKPNFFDFEGKQKWEAWKALGDSSPSQA 110

  Fly    69 KEAYVKVYEKYAP 81
            .:.|:...:|..|
  Rat   111 MQEYIAAVKKLDP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..84 CDD:469667 25/78 (32%)
Acbd6NP_001011906.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
ACBP 43..118 CDD:459982 23/71 (32%)
ANKYR <166..>261 CDD:440430
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.