DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and SPBC1539.06

DIOPT Version :9

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_596820.1 Gene:SPBC1539.06 / 2539982 PomBaseID:SPBC1539.06 Length:87 Species:Schizosaccharomyces pombe


Alignment Length:81 Identity:37/81 - (45%)
Similarity:48/81 - (59%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDA 67
            :||:||...|...:.|...|.|:.|.|||||||||.|.:|||:||||.|..:.||...||.||:.
pombe     4 TFEQAAADVKELKETPNSDELLKLYALFKQATVGDNNTEKPGLLDLKGKFKWNAWEELKGKSKED 68

  Fly    68 AKEAYVKVYEKYAPKY 83
            |...|:...::...||
pombe    69 AASEYISFVDELKTKY 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..81 CDD:395715 35/76 (46%)
SPBC1539.06NP_596820.1 ACB 1..86 CDD:226731 37/81 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101568
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.