DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and acbp-6

DIOPT Version :10

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_496552.1 Gene:acbp-6 / 189453 WormBaseID:WBGene00012457 Length:115 Species:Caenorhabditis elegans


Alignment Length:86 Identity:31/86 - (36%)
Similarity:47/86 - (54%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSFEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDV-NID---KPGILDLKKKAMYEAWNAHKG 62
            ::||.|||..:....:|||.|.|:.|.|:|||..||: |.|   .|...::.:| .|.||.:.||
 Worm    13 LTFEIAAEEMRRLKSEPTDRERLKLYALYKQALHGDIPNEDVYPVPAGDEVGRK-KYAAWKSQKG 76

  Fly    63 LSKDAAKEAYVKVYEKYAPKY 83
            .:.:..:..||.:.|:...||
 Worm    77 ANSEKCRADYVAIAEEMIKKY 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..84 CDD:469667 31/84 (37%)
acbp-6NP_496552.1 ACBP 15..98 CDD:469667 31/84 (37%)

Return to query results.
Submit another query.