powered by:
Protein Alignment Acbp4 and acbp-5
DIOPT Version :9
Sequence 1: | NP_648081.1 |
Gene: | Acbp4 / 38781 |
FlyBaseID: | FBgn0035742 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499817.2 |
Gene: | acbp-5 / 176800 |
WormBaseID: | WBGene00011731 |
Length: | 274 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 22/73 - (30%) |
Similarity: | 35/73 - (47%) |
Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDK-PGILDLKKKAMYEAWNAHKGLSKDA 67
|:.|......|..|......|:||||:|||..|..:..| |...:...:..:.:|.|:..:|:..
Worm 32 FDAATTRLPGFLTKIDQKTILKFYGLYKQAVEGPADSKKGPYWFETVARKKFNSWLANSQMSRSR 96
Fly 68 AKEAYVKV 75
|.|||.::
Worm 97 AMEAYCEL 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.