DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp4 and Dbil5

DIOPT Version :10

Sequence 1:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_067269.1 Gene:Dbil5 / 13168 MGIID:108039 Length:87 Species:Mus musculus


Alignment Length:81 Identity:33/81 - (40%)
Similarity:41/81 - (50%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSFEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKD 66
            |.||.|....|......:|.|.|..|..:||||.||.||..|...|::.||.||||..:||:||.
Mouse     4 VEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKM 68

  Fly    67 AAKEAYVKVYEKYAPK 82
            .|...|:...|:...|
Mouse    69 DAMRIYIAKVEELKKK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp4NP_648081.1 ACBP 4..84 CDD:469667 32/79 (41%)
Dbil5NP_067269.1 ACBP 2..86 CDD:238248 33/81 (41%)

Return to query results.
Submit another query.