DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msl-3 and Arid4b

DIOPT Version :9

Sequence 1:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_008769986.1 Gene:Arid4b / 84481 RGDID:619919 Length:1319 Species:Rattus norvegicus


Alignment Length:233 Identity:46/233 - (19%)
Similarity:87/233 - (37%) Gaps:51/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CYEPDKSKARVLYTSKVLNVFERRNEHGLRFYE--------------YKIHFQGWRPSYDRCVRA 69
            ||.|. .|.:|.|.       ..:|:   :.||              |.:|:.||...||..::|
  Rat   568 CYPPG-MKVQVRYG-------RGKNQ---KMYEASIKDSDVEGGEVLYLVHYCGWNVRYDEWIKA 621

  Fly    70 TVLLKDTEEN-RQLQRELAEAAKLQIRGDYSYKGTPDKPSAKKKRGGKAAHVEEP---IVVPM-- 128
            ..:::..::| .:::.......||....|...|.:|  .:.|.:|..|:.....|   :|..:  
  Rat   622 DKIVRPADKNVPKIKHRKKIKNKLDKEKDRDEKYSP--KNCKLRRLSKSPFQSNPSPEMVSKLDL 684

  Fly   129 ------DTGHLEA-------EHEMAPTPRAAGNRTRDNSGGKRKEKPPSGDGRLKGNRGRQTETF 180
                  ||||:::       ....|....|..:...:....:..|.....:.:::.:...::|..
  Rat   685 ADAKNSDTGHIKSIEITSILNGLQASESSAEDSEQEEERCAQDPESSSKDESKVEHSAHSRSELI 749

  Fly   181 YNNAINDVSVY--NHVPQEDRIMMRVS---ERLRELIE 213
            ....::..|:.  |.|..:..|...||   ||||:.:|
  Rat   750 SKEELSSPSLLEENKVHPDLVIAKTVSKSPERLRKDVE 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 8/21 (38%)
Arid4bXP_008769986.1 TUDOR 58..113 CDD:197660
RBB1NT 169..262 CDD:285392
ARID 311..394 CDD:198082
Tudor-knot 571..624 CDD:288553 14/63 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.