DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msl-3 and AT1G02740

DIOPT Version :9

Sequence 1:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_171774.2 Gene:AT1G02740 / 839455 AraportID:AT1G02740 Length:327 Species:Arabidopsis thaliana


Alignment Length:498 Identity:98/498 - (19%)
Similarity:158/498 - (31%) Gaps:230/498 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRCVRATVLLKD 75
            |.:||.||....|     ..|.:|||.|..:.||     ::|.:|:.||..|:|..:|...|||.
plant    52 FEEGERVLAKHSD-----CFYEAKVLKVEFKDNE-----WKYFVHYIGWNKSWDEWIRLDCLLKH 106

  Fly    76 TEENRQLQRELAEAAKLQ-IRGDYSYKGTPDKP-SAKKKRGGKAAHVEEPIVVPMDTGHLEAEHE 138
            ::||.:.|:|  :..|.| |:...::|.:..|| |....||                        
plant   107 SDENIEKQKE--QGLKQQGIKSAMAWKVSKMKPRSPNVARG------------------------ 145

  Fly   139 MAPTPRAAGNRTRDNSGGKRKEKPPSGDGRLKGNRGRQTETFYNNAINDVSVYNHVPQEDRIMMR 203
                               ||.|..|.|          ||.            |.:|.::.:...
plant   146 -------------------RKRKQDSVD----------TEK------------NVLPSDNLLSFN 169

  Fly   204 VSERLRELIEYDRNMIKVLGKQHALPARVPIVTIMENFVKQQAVELAISIKQDSSRARNTQSRNA 268
            :...||:.:..|...:..:.|...||....:..|::.::..|.                      
plant   170 IPPALRKQLLDDFEFVTQMQKLVQLPRSPNVDGILKKYIDSQM---------------------- 212

  Fly   269 RMEREYDRVMSTVCMLKEVVDGLRIYFEFHVDDHLLYTEEKEYVHNYLTDDNMRNCSLILNKSYE 333
               :::.||..:   |:|::.|||.||:..:...|||..|:                    |.||
plant   213 ---KKHGRVTDS---LEEILKGLRCYFDKALPVMLLYNNER--------------------KQYE 251

  Fly   334 YINPSGDTELIGLDGTPVVEGSGDTNGQIGVINIGGPEYEKQLQKCLLYIVTASGKNTAQAYERT 398
                    |.:.                      ||                            .
plant   252 --------ESVS----------------------GG----------------------------V 258

  Fly   399 SPYTAAYKLPVEMRGFLNETFKWRLLSAESPPEKSMVFGAPHLVRLMIKMPMFLNASPISNKKLE 463
            ||                                |.|:||.||:||.:|:|..|....::.:.|:
plant   259 SP--------------------------------STVYGAEHLLRLFVKLPELLVHVNMAEETLK 291

  Fly   464 DLLPHLDAFINYLENHREWFDREN----FVNSTALPQEDLQRE 502
            :|   .|.|::.|.     |.|:|    || ||....|:::::
plant   292 EL---QDNFVDILR-----FLRKNQSVLFV-STYKAVEEMEKK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 46/289 (16%)
AT1G02740NP_171774.2 PLN00104 4..>101 CDD:215056 20/58 (34%)
CBD_MSL3_like 56..112 CDD:350846 23/65 (35%)
MRG 148..315 CDD:399022 57/335 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10880
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.