DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msl-3 and Msl3l2

DIOPT Version :9

Sequence 1:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001157305.1 Gene:Msl3l2 / 73390 MGIID:1920640 Length:371 Species:Mus musculus


Alignment Length:394 Identity:89/394 - (22%)
Similarity:149/394 - (37%) Gaps:99/394 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 GNRTRDNSGGKRKEKPPSGDGRLKGNRGRQTETFYNNAINDVSVYNHVPQEDRIMMRVSE----- 206
            |...:|:..||.:.....|||..|....::.|.......::.::  .:|..:.:..|:::     
Mouse     5 GCAPKDDGEGKDEGGSDRGDGDSKPKGKKEVEPHTRREADERAM--RIPIPEVLQQRLADDCYYI 67

  Fly   207 -RLRELIEYDRNMIKVLGKQHALPARVPIVTIMENFVKQ-QAVELAISIKQDSSRARNTQSRNAR 269
             |.|.|:.              ||.:..:..|:|.:|:. .|..||:.       .|..|.:.|.
Mouse    68 NRRRRLVR--------------LPCQTNVGAILECYVRHFSASVLALG-------DRRPQPQRAA 111

  Fly   270 MEREYDRVMSTVCMLKEVVDGLRIYFEFHVDDHLLYTEEK-EYVHNYLTDDNMRNCSLILNKSYE 333
            .||       :|.:.:|:.|||||.|:..:...|||.:|: :|        .|...|.....:.|
Mouse   112 PER-------SVGLCREMADGLRITFDHALPLVLLYPQEQAQY--------EMVTSSTFFFPTEE 161

  Fly   334 YINPSGDTELIGLDGTPVVEGSGDTNGQIGVINIGGPEYEKQLQKCLLYIVTASGKNTA------ 392
            ..:.:|.::.....|....:.|...       .:.||...|: ::.......|..::|.      
Mouse   162 RASDAGRSQEAPWPGPSPPQPSESQ-------AVAGPAAPKR-RRAEAEATRAPRRSTRHSTHCH 218

  Fly   393 -QAYERTSP---------YTAAYKLPVE------------------MRGF------LNETFKWRL 423
             ||.:|.||         :....|.||.                  ..||      :||...|:|
Mouse   219 WQAEDRASPQAKRSVPKLFPHLQKTPVHSAAPSPIALTPGKEGSAMFAGFEGTTEEINEILSWKL 283

  Fly   424 L-----SAESPPEKSMVFGAPHLVRLMIKMPMFLNASPISNKKLEDLLPHLDAFINYLENHREWF 483
            :     ....||..|.::||.||:||.:|:|..|.....|.|.|:.||.|||.|:.:|..::..|
Mouse   284 VPDNYPPGHQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHLDLFLRFLAEYQADF 348

  Fly   484 DREN 487
            ..|:
Mouse   349 FLES 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 78/342 (23%)
Msl3l2NP_001157305.1 MRG 33..356 CDD:368575 81/366 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839821
Domainoid 1 1.000 79 1.000 Domainoid score I8659
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4236
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47495
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006694
OrthoInspector 1 1.000 - - otm42726
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4893
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.