DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msl-3 and Morf4l2

DIOPT Version :9

Sequence 1:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001161697.1 Gene:Morf4l2 / 56397 MGIID:1927167 Length:288 Species:Mus musculus


Alignment Length:431 Identity:74/431 - (17%)
Similarity:133/431 - (30%) Gaps:178/431 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KPSAKKKRGGKAA---HVEEPIVVPMDTGHLEAEHEMAPTPRAAGNRTRD-------NSGGKRKE 160
            :..|.:.||.::|   :.::|....|....:..   .|...::||::.::       ..||:..|
Mouse     4 RKQASQTRGQQSAEEDNFKKPTRSNMQRSKMRG---AASGKKSAGSQPKNLDPALPGRWGGRSAE 65

  Fly   161 KPPSGDGRLKGNRGRQTETFYNNAINDVSVYNHVPQEDR---------------------IMMRV 204
            .||||..| |..:.:|...    ...|....:.|||..|                     :.:::
Mouse    66 NPPSGSVR-KTRKNKQKAP----GNGDGGSTSEVPQPPRKKRARADPTVESEEAFKSRMEVKVKI 125

  Fly   205 SERLRELIEYDRNMIKVLGKQHALPARVPIVTIMENFVKQQAVELAISIKQDSSRARNTQSRNAR 269
            .|.|:..:..|.:::....:...|||:..:..|:|.:.         :.|:......|       
Mouse   126 PEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYA---------NCKKSQGNVDN------- 174

  Fly   270 MEREYDRVMSTVCMLKEVVDGLRIYFEFHVDDHLLYTEEKEYVHNYLTDDNMRNCSLILNKSYEY 334
              :||        .:.|||.|::.||...:...|||..|:                         
Mouse   175 --KEY--------AVNEVVGGIKEYFNVMLGTQLLYKFER------------------------- 204

  Fly   335 INPSGDTELIGLDGTPVVEGSGDTNGQIGVINIGGPEYEKQLQKCLLYIVTASGKNTAQAYERTS 399
                                               |:|.:                         
Mouse   205 -----------------------------------PQYAE------------------------- 209

  Fly   400 PYTAAYKLPVEMRGFLNETFKWRLLSAESPPEKSMVFGAPHLVRLMIKMPMFLNASPISNKKLED 464
                                   :|.|......|.::|||||:||.:::...|..:|:..|.|..
Mouse   210 -----------------------ILLAHPDAPMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLAL 251

  Fly   465 LLPHLDAFINYL-ENHREWFDRENFVNSTALPQEDLQRELL 504
            ||.:|..|:.|| :|....|...::..::|    |..|:.|
Mouse   252 LLGYLHDFLKYLAKNSASLFTASDYKVASA----DYHRKAL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 48/311 (15%)
Morf4l2NP_001161697.1 PLN02967 1..>150 CDD:215521 27/153 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 24/118 (20%)
MRG 102..276 CDD:368575 46/307 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.