DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msl-3 and morf4l1

DIOPT Version :9

Sequence 1:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001002604.2 Gene:morf4l1 / 436877 ZFINID:ZDB-GENE-040718-348 Length:323 Species:Danio rerio


Alignment Length:508 Identity:101/508 - (19%)
Similarity:170/508 - (33%) Gaps:217/508 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTELRDETPLFHKGEIVLCYEPDKSKARVLYTSKV--LNVFERRNEHGLRFYEYKIHFQGWRPSY 63
            |...:|..|.|.:||.|||:.     ..:||.:|.  :|:.:::       .:|.||:.||..::
Zfish     1 MAPKQDPKPKFQEGERVLCFH-----GPLLYEAKCVKINIKDKQ-------VKYFIHYSGWNKNW 53

  Fly    64 DRCVRATVLLKDTEENRQLQRELAEAAKLQIRGDYSYKGTPDKPSAKKKRGGKAAHVEEPIVVPM 128
            |..|..:.:||..:.|.|.|:||.:|.:     |:..:|        :.||              
Zfish    54 DEWVPESRVLKYVDSNLQKQKELQKANQ-----DHYVEG--------RMRG-------------- 91

  Fly   129 DTGHLEAEHEMAPTPRAAG--NRTRDNSGGKRKEKPP-SGDGRLKGN--------RGR------Q 176
                      :||:.:.|.  .:..|....|.|:|.| :|:|...|:        |.|      .
Zfish    92 ----------VAPSKKIAAVQQKNVDVKTKKNKQKTPGAGEGTSTGDMPHPPRKKRARVDPTVES 146

  Fly   177 TETFYNNAINDVSVYNHVPQEDRIMMRVSERLRELIEYDRNMIKVLGKQHALPARVPIVTIMENF 241
            .|||    ||.|.|...:|:|          |:..:..|.::|....:...|||:..:..::|::
Zfish   147 EETF----INRVEVKVKIPEE----------LKPWLVDDWDLITRQKQLFHLPAKKNVDAVLEDY 197

  Fly   242 VKQQAVELAISIKQDSSRARNTQSRNARMEREYDRVMSTVCMLKEVVDGLRIYFEFHVDDHLLYT 306
                              |...:||.....:||        .:.|||.|:|.||...:...|||.
Zfish   198 ------------------ANYKKSRGNSDNKEY--------AVNEVVAGIREYFNVMLGTQLLYK 236

  Fly   307 EEKEYVHNYLTDDNMRNCSLILNKSYEYINPSGDTELIGLDGTPVVEGSGDTNGQIGVINIGGPE 371
            .|:                                                            |:
Zfish   237 FER------------------------------------------------------------PQ 241

  Fly   372 YEKQLQKCLLYIVTASGKNTAQAYERTSPYTAAYKLPVEMRGFLNETFKWRLLSAESPPEKSMVF 436
            |.:         :.|:..:|:.                                       |.::
Zfish   242 YAE---------ILANHPDTSM---------------------------------------SQIY 258

  Fly   437 GAPHLVRLMIKMPMFLNASPISNKKLEDLLPHLDAFINYL-ENHREWFDRENF 488
            |||||:||.:::...|..:|:..|.|..||.:|..|:.|| :|....|...::
Zfish   259 GAPHLLRLFVRIGAMLAYTPLDEKSLALLLSYLQDFLKYLVKNSSSLFSASDY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 48/290 (17%)
morf4l1NP_001002604.2 Tudor-knot 11..64 CDD:288553 17/64 (27%)
MRG 135..309 CDD:283390 58/321 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.