DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msl-3 and Morf4l1

DIOPT Version :9

Sequence 1:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_008764667.1 Gene:Morf4l1 / 300891 RGDID:1307938 Length:362 Species:Rattus norvegicus


Alignment Length:539 Identity:106/539 - (19%)
Similarity:168/539 - (31%) Gaps:240/539 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTELRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGW------ 59
            |...:|..|.|.:||.|||:.     ..:||.:|.:.|..:..:     .:|.||:.||      
  Rat     1 MAPKQDPKPKFQEGERVLCFH-----GPLLYEAKCVKVAIKDKQ-----VKYFIHYSGWNKKSAV 55

  Fly    60 RP---------------------------------SYDRCVRATVLLKDTEENRQLQRELAEA-- 89
            ||                                 |:|..|..:.:||..:.|.|.||||.:|  
  Rat    56 RPRRSEKSLKTREDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDANLQKQRELQKANQ 120

  Fly    90 ---AKLQIRGDYSYKGTPDKPSAKKKRGGKAAHVEEPIVVPMDTGHLEAEHEMAPTPRAAGNRTR 151
               |:.::||     ..|    .||..|.:..:||           ::.:.....||   ||   
  Rat   121 EQYAEGKMRG-----AAP----GKKTSGLQQKNVE-----------VKTKKNKQKTP---GN--- 159

  Fly   152 DNSGGKRKE--KPPSGDGRLKGNRGRQT----ETFYNNAINDVSVYNHVPQEDRIMMRVSERLRE 210
             ..||...|  :||    |.|..|...|    |||.|..              .:.:::.|.|:.
  Rat   160 -GDGGSTSETPQPP----RKKRARVDPTVENEETFMNRV--------------EVKVKIPEELKP 205

  Fly   211 LIEYDRNMIKVLGKQHALPARVPIVTIMENFVKQQAVELAISIKQDSSRARNTQSRNARMEREYD 275
            .:..|.::|....:...|||:..:.:|:|::                  |...:||.....:|| 
  Rat   206 WLVDDWDLITRQKQLFYLPAKKNVDSILEDY------------------ANYKKSRGNTDNKEY- 251

  Fly   276 RVMSTVCMLKEVVDGLRIYFEFHVDDHLLYTEEKEYVHNYLTDDNMRNCSLILNKSYEYINPSGD 340
                   .:.|||.|::.||...:...|||..|:                               
  Rat   252 -------AVNEVVAGIKEYFNVMLGTQLLYKFER------------------------------- 278

  Fly   341 TELIGLDGTPVVEGSGDTNGQIGVINIGGPEYEKQLQKCLLYIVTASGKNTAQAYERTSPYTAAY 405
                                         |:|.:                               
  Rat   279 -----------------------------PQYAE------------------------------- 283

  Fly   406 KLPVEMRGFLNETFKWRLLSAESPPEKSMVFGAPHLVRLMIKMPMFLNASPISNKKLEDLLPHLD 470
                             :|:.......|.|:|||||:||.:::...|..:|:..|.|..||.:|.
  Rat   284 -----------------ILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLH 331

  Fly   471 AFINYL-ENHREWFDRENF 488
            .|:.|| :|....|...::
  Rat   332 DFLKYLAKNSATLFSASDY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 48/290 (17%)
Morf4l1XP_008764667.1 Tudor-knot 11..103 CDD:288553 20/101 (20%)
MRG 174..348 CDD:283390 55/321 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.