DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msl-3 and Arid4a

DIOPT Version :9

Sequence 1:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_036013289.1 Gene:Arid4a / 238247 MGIID:2444354 Length:1283 Species:Mus musculus


Alignment Length:504 Identity:97/504 - (19%)
Similarity:158/504 - (31%) Gaps:141/504 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SKARVLY----TSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRCVRATVLLKDTEENRQLQRE 85
            :|.:|.|    |.|:.....:..|.......|.:|:.||...||..|:|..::...:        
Mouse   580 TKVKVKYGRGKTQKIYEASIKSTEMDDGEILYLVHYYGWNVRYDEWVKADRIIWPLD-------- 636

  Fly    86 LAEAAKLQIRGDYSYKGTPDKPSAKKKRGGKAAHVEEPIVVPMDTGHLEAEHEMAPTPRAAGNRT 150
                           ||.|.|...||.:           ..|....|....|...|.| |..|:.
Mouse   637 ---------------KGGPKKKQKKKVK-----------CQPCLLAHCTLGHAFCPVP-AVENKE 674

  Fly   151 RDNSGGKRKEKPPSGDGRLKGNRGRQ--TETFYNNAINDVSVYNHVPQEDRIMMRVSERLRELIE 213
            ......||.|:      |.|..|||.  ..||..|....:|..::  .|.:     |:......|
Mouse   675 DSEKDEKRDEE------RQKSKRGRPPLKSTFSPNMPYSLSKTSN--SEGK-----SDSCSSDSE 726

  Fly   214 YDRNMIKVLGKQHALPARVPIVTIMENFVKQQAVELAISIKQDSSRARNTQS--------RNARM 270
            .|..:.|..|.:                      :|:..:|::..:..|...        :...:
Mouse   727 ADDQLEKSSGGE----------------------DLSPDVKEELEKNENAHDDKLDEENPKIVHI 769

  Fly   271 EREYDRVMS--TVCMLKEVVDGLRIYFEFHVDDHLLYTEE-KEYVHNYLTDDNMRNCSLILNKSY 332
            .:|.||..:  :..:..|..|..:|...|  .|.:...|| |:.|.........|:.:..|:...
Mouse   770 SKENDRTQAQPSDTLTVEAGDSDQIVHIF--GDKVDQVEEFKKQVEKSPKGKGRRSKTKDLSLEL 832

  Fly   333 EYINPSGDTELIGLDGTPVVEGSGDTNGQIGVINIGGPEYEKQLQKCLLYIVTASGKNTAQAYER 397
            ..|:|.|..           |...:.:|.:..:.....|       |         ||.:...:.
Mouse   833 IKISPFGQE-----------EAGSEAHGDVHSLEFSSLE-------C---------KNFSSTEDD 870

  Fly   398 TSPYTAAYKLPVEMRGFLNETFKWRLLSAESPPEKSMVFGAPHLVRLMIKMPMFLNASPISNKKL 462
            ..||....||            |.::|..:||.:|         :||...|.|   .:.:|.::.
Mouse   871 IDPYEKEKKL------------KRKILGQQSPEKK---------LRLDNGMEM---TTGVSQERS 911

  Fly   463 EDLLPHLDAFINYLENHREWFDRENFVNSTALPQEDLQRELLDSLDGIA 511
            :|..........::|.|.| .:.|...:.||.|.:.||....:..|..|
Mouse   912 DDGAGAEGMKGAHVEQHFE-TEGEGMPSLTAEPDQGLQELTSEKSDSPA 959

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 50/300 (17%)
Arid4aXP_036013289.1 Tudor_ARID4A_rpt1 4..61 CDD:410530
Tudor_SF 62..118 CDD:413384
RBB1NT 170..262 CDD:400474
ARID_ARID4A 312..397 CDD:350646
CBD_RBP1_like 580..638 CDD:350843 14/80 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.