DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msl-3 and cec-7

DIOPT Version :10

Sequence 1:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001022827.1 Gene:cec-7 / 176704 WormBaseID:WBGene00012551 Length:499 Species:Caenorhabditis elegans


Alignment Length:221 Identity:45/221 - (20%)
Similarity:81/221 - (36%) Gaps:73/221 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRCVRATVLLKDTEE 78
            ||:|.|....|     :|.:.:.::  :.::.|...  |.|||:||...||.             
 Worm   328 GELVACTYKGK-----VYDAVITDI--KPDKDGKEC--YCIHFKGWNNRYDE------------- 370

  Fly    79 NRQLQRELAEAAKLQIRGDYSYKGTPDKPSAKKKRGGKAAHVEEPIVVPMDTGHLEAEHEMAPTP 143
                |..:.|..      |..:||..|        |.:|     |:|....:..   .||.:..|
 Worm   371 ----QIPIGEET------DRIFKGIAD--------GYRA-----PVVTMRKSAR---NHEKSTEP 409

  Fly   144 RAAGNRTRDNSG---GKRKEKPPSGDGRLKGNRGRQTETFYNNAINDV--------------SVY 191
            :|    |::|:.   |||:|:...|:.......|:..:.:..:.|.|.              |.|
 Worm   410 QA----TKENAPRLVGKRREQFIIGEQVTCTQNGKPYDAYIVDIITDTDGKDFYCVHFKGWNSRY 470

  Fly   192 NH-VP---QEDRIMMRVSERLRELIE 213
            :. :|   ::.|:....:.:..|::|
 Worm   471 DEKIPVGEEQGRLFKGSAAKYAEMLE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 CD_CSD 15..81 CDD:475127 14/65 (22%)
MRG 196..490 CDD:461721 3/18 (17%)
cec-7NP_001022827.1 MBT 11..>58 CDD:459242
PTZ00121 <77..>305 CDD:173412
MBT 325..383 CDD:459242 18/86 (21%)
MBT <439..485 CDD:459242 7/45 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.