DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msl-3 and cec-7

DIOPT Version :9

Sequence 1:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001022827.1 Gene:cec-7 / 176704 WormBaseID:WBGene00012551 Length:499 Species:Caenorhabditis elegans


Alignment Length:221 Identity:45/221 - (20%)
Similarity:81/221 - (36%) Gaps:73/221 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRCVRATVLLKDTEE 78
            ||:|.|....|     :|.:.:.::  :.::.|...  |.|||:||...||.             
 Worm   328 GELVACTYKGK-----VYDAVITDI--KPDKDGKEC--YCIHFKGWNNRYDE------------- 370

  Fly    79 NRQLQRELAEAAKLQIRGDYSYKGTPDKPSAKKKRGGKAAHVEEPIVVPMDTGHLEAEHEMAPTP 143
                |..:.|..      |..:||..|        |.:|     |:|....:..   .||.:..|
 Worm   371 ----QIPIGEET------DRIFKGIAD--------GYRA-----PVVTMRKSAR---NHEKSTEP 409

  Fly   144 RAAGNRTRDNSG---GKRKEKPPSGDGRLKGNRGRQTETFYNNAINDV--------------SVY 191
            :|    |::|:.   |||:|:...|:.......|:..:.:..:.|.|.              |.|
 Worm   410 QA----TKENAPRLVGKRREQFIIGEQVTCTQNGKPYDAYIVDIITDTDGKDFYCVHFKGWNSRY 470

  Fly   192 NH-VP---QEDRIMMRVSERLRELIE 213
            :. :|   ::.|:....:.:..|::|
 Worm   471 DEKIPVGEEQGRLFKGSAAKYAEMLE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 3/18 (17%)
cec-7NP_001022827.1 CHROMO 30..>56 CDD:214605
CHROMO 344..>374 CDD:214605 10/50 (20%)
Tudor-knot 427..476 CDD:288553 6/48 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.