DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr67Fa1

DIOPT Version :9

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster


Alignment Length:125 Identity:66/125 - (52%)
Similarity:91/125 - (72%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FFVLAVAALAVSCVQADSF---DARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGVGGYYASG 65
            |..|.||:..::|....:.   :|.|...:..||::.:|:|.|||:||||||.||||:||.:|:|
  Fly     2 FRYLLVASAILACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGIGGNHANG 66

  Fly    66 SNAYYAPDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIRTHPQ---QESRQ 122
            ..::|:|:|:|:|::|.||.|||.|.||.|||||||||:||:||||||||||   ||.|:
  Fly    67 GFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHPQYVEQEYRR 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 27/46 (59%)
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 27/46 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470139
Domainoid 1 1.000 70 1.000 Domainoid score I16502
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 1 1.000 - - FOG0014398
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3799
87.850

Return to query results.
Submit another query.