DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr49Af

DIOPT Version :9

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001286347.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:128 Identity:45/128 - (35%)
Similarity:70/128 - (54%) Gaps:12/128 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGV--------GGY 61
            :::.:|...|:....|:.|..::    :|:::.:|.|.|.|:..:|....:.||        .|.
  Fly     3 YLMLIALFVVAASATDNDDPISQ----ESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGE 63

  Fly    62 YASGSNAYYAPDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIRTHPQQESRQGQ 124
            ..:|..::.|.||:...::||||.|||...|.|||||||.|.|:||:|||||.||.:...|.|
  Fly    64 SVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHPYKTPEQKQ 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 16/54 (30%)
Cpr49AfNP_001286347.1 Chitin_bind_4 35..90 CDD:278791 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.