DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr47Eg

DIOPT Version :9

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster


Alignment Length:122 Identity:44/122 - (36%)
Similarity:65/122 - (53%) Gaps:11/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFFVLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESG-VGG--YYAS 64
            |||:.....|||:....|:...|||     ..:..|| :||..:..|.:..|:.| :.|  :...
  Fly     2 KFFIAFACLLAVALANEDANVLRAE-----QQVNVDG-FAYAVELDNSVNVQQKGDLNGEEWVVK 60

  Fly    65 GSNAYYAPDGQLIQLTYTADSNGYHPAGAH--LPTPPPIPASILKSLEYIRTHPQQE 119
            ||.::.:|:...:.:.|.||:|||....|:  ||||||||.:|.:|||||..||..:
  Fly    61 GSQSWTSPENVPVSIQYIADANGYQVVSANPPLPTPPPIPEAIQRSLEYIAAHPPSQ 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 13/49 (27%)
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.