DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr47Ee

DIOPT Version :9

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:145 Identity:34/145 - (23%)
Similarity:55/145 - (37%) Gaps:50/145 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YKSDLKEDGSYAYQYQTSNGIAGQE----------SGVGGYYASGSNAYYAPDGQLIQLTYTADS 85
            |:::|..|||::|.|.:::|...|.          .||......||.:|.:|:|..|.:.|.||.
  Fly   110 YQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADE 174

  Fly    86 NGYHPAGAHLPT------------------------------PPPIP----------ASILKSLE 110
            ||:...|..:|:                              |||:|          ...|..|:
  Fly   175 NGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNLNPYQTPFRQLPPPLPNAPFRPQLPGQQPLTPLQ 239

  Fly   111 YIRTHPQQESRQGQG 125
            ..:...||:.:|.:|
  Fly   240 QQQQQQQQQLQQQRG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 16/56 (29%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.