DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:142 Identity:54/142 - (38%)
Similarity:74/142 - (52%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFFVLAVAALAVSCVQADSFDARAETR-----------EYKSDLKEDGSYAYQYQTSNGIAGQES 56
            ::.:|.:|||.:|..|     ||.:.|           ..:.::..||||.|.|:|.|||..:|.
  Fly     2 QYTLLFIAALLLSLAQ-----ARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEE 61

  Fly    57 GV--------GGYYASGSNAYYAPDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIR 113
            |.        .|..|.||.:|.:|:|..|::||.||.||:.|.|.|||||||||.:|.|:|.|:.
  Fly    62 GYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLA 126

  Fly   114 THPQQESRQGQG 125
            |.|.....|..|
  Fly   127 TAPPPPQEQPGG 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 22/54 (41%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439302
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.