DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr65Ax1

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster


Alignment Length:111 Identity:38/111 - (34%)
Similarity:52/111 - (46%) Gaps:27/111 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KINVVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGI----YNYQFETSNGIAQQEQGV 63
            |..:|:....:|.|   |.|:            |..|:.:..:    |:|..|||:|.::.|:||
  Fly     2 KFAIVLFALFAVAL---AAPT------------VEVLRSDSNVGIDNYSYAVETSDGTSKSEEGV 51

  Fly    64 --------GGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLP 101
                    ......||..|..|:||...:||.||||||||||.|||
  Fly    52 LKNAGTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 21/54 (39%)
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.