DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR117

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_001688322.1 Gene:CPR117 / 5667562 VectorBaseID:AGAP003379 Length:162 Species:Anopheles gambiae


Alignment Length:102 Identity:29/102 - (28%)
Similarity:44/102 - (43%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLVAMSVLLGVQA------RPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIA-------- 57
            :|.||.:|.:|..|      .|..:..|.|::.:.|.....:|...|.|:..|..||        
Mosquito    11 IVAVANAVAIGYPAPLGAYHAPLGAYPAVAKVAAPVVAKVADDYDPNPQYSYSYHIADALTGDNK 75

  Fly    58 QQEQGVGGYYASGSSQYYTPEGQLIQLTYTADE-NGF 93
            :|::...|...:||.....|:|....:.||||. |||
Mosquito    76 EQQESRSGDVVTGSYSLVEPDGTRRVVEYTADPVNGF 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 16/55 (29%)
CPR117XP_001688322.1 Chitin_bind_4 60..112 CDD:278791 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.