DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR151

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_001238069.3 Gene:CPR151 / 4578144 VectorBaseID:AGAP009870 Length:153 Species:Anopheles gambiae


Alignment Length:149 Identity:42/149 - (28%)
Similarity:70/149 - (46%) Gaps:25/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKINVVVLVAMSVLLGV------QARPSDSPDAHAEIRSF----------VNELKQEDGIYNYQ 49
            |.|: ||:|...||::|.      |.:.......|.:.:|.          :..:.:.||.:.|.
Mosquito     1 MMKL-VVLLAVFSVIVGAQKQHQQQQQHQQQQQQHHQQQSLPRYKEIPIVNLENVLEVDGKFRYS 64

  Fly    50 FETSNGIAQQEQG----VGGYYASGSSQYYT---PEGQLIQLTYTADENGFQPQGEHLPTPHPIP 107
            :|..:|....:.|    |.....:.|...||   .:|:...::|.|||||::|.|:|||||.|:|
Mosquito    65 YEGGDGTRAAQDGQQIVVNNQVGTASQGQYTYQGDDGKTYSISYIADENGYRPVGDHLPTPPPVP 129

  Fly   108 EAILKSLEY-NRNHPEEDG 125
            ..|.::|.: .:..|.:||
Mosquito   130 APIARALAHLAKLPPSKDG 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 14/53 (26%)
CPR151XP_001238069.3 Chitin_bind_4 61..115 CDD:278791 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.