DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Lcp65Ae

DIOPT Version :10

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:73 Identity:30/73 - (41%)
Similarity:40/73 - (54%) Gaps:10/73 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LKQEDGIYNYQ--FETSNGIAQQEQGVGGY--------YASGSSQYYTPEGQLIQLTYTADENGF 93
            |:.:.|..|:|  ||||:|.|...:|...|        ...||.::...:||..::.|.||||||
  Fly    24 LESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQGSFRFVADDGQTYEVNYIADENGF 88

  Fly    94 QPQGEHLP 101
            ||||.|||
  Fly    89 QPQGAHLP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 19/56 (34%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:459790 18/54 (33%)

Return to query results.
Submit another query.