DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:98 Identity:24/98 - (24%)
Similarity:38/98 - (38%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVVLVAMSVLLGV---QARPSDSPDAHAEIRSFVNELKQED--GIYNYQFETSNGIAQQEQG--- 62
            |:.|...:|..|.   .|.|.....|...:.:...||::.|  ..|.|.::..:.::...:|   
  Fly     6 VIALALFAVAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVE 70

  Fly    63 -VGGYYASGSSQYYTPEGQLIQLTYTADE-NGF 93
             ..|....|.......:|....:|||||. |||
  Fly    71 ERDGDVVRGEYSLIDADGFKRTVTYTADSINGF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 12/51 (24%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 12/51 (24%)

Return to query results.
Submit another query.