DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr78Cb

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001262144.1 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster


Alignment Length:120 Identity:47/120 - (39%)
Similarity:60/120 - (50%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG-----VGGYYASGSSQY 74
            |:|...|       .|.|..|......::|::.|.|:|||||..|..|     :|.|      .|
  Fly    31 LVGASER-------DARITDFRVSPTDDEGVFKYAFKTSNGIDVQAAGSPLETIGIY------SY 82

  Fly    75 YTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPEEDGEYEH 129
            .:|||..|:..|.|||.||...|.|||.|.|.|:.||:||||.|.| .|||..::
  Fly    83 TSPEGVPIETRYIADELGFHVVGRHLPQPPPTPDYILRSLEYIRTH-TEDGNLKN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 20/51 (39%)
Cpr78CbNP_001262144.1 Chitin_bind_4 55..101 CDD:278791 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.