DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr76Ba

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:128 Identity:31/128 - (24%)
Similarity:45/128 - (35%) Gaps:46/128 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DSPDAHA--EIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGGYYASGSSQYYTPEGQLIQLTY 86
            :.|..|.  |....|.:.|..|  ...|:||.:|    ::..|||....:      :|:...:.|
  Fly    92 EEPKHHPKYEFNYGVKDTKTGD--IKQQWETRDG----DKVKGGYTMKEA------DGRTRIVEY 144

  Fly    87 TAD-ENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPEEDGEYEHHDHHHDHHEHHQSHGQEQG 148
            ||| .||||...:|:                               .|..|.||..|:||:.|
  Fly   145 TADSHNGFQATVKHV-------------------------------GHASHLEHSHSYGQQYG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 13/47 (28%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.