DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:118 Identity:54/118 - (45%)
Similarity:78/118 - (66%) Gaps:5/118 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INVVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGGYYA 68
            |...:::::.::..::|    :.::.||...:.||:| .||.|::::.|||||..||.||||..|
  Fly     2 IKTALIISLFLVAAIRA----ADESQAETTKYRNEIK-PDGSYSWEYGTSNGIDAQESGVGGVQA 61

  Fly    69 SGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHP 121
            :||..|..|:|..|||.|||||||::|.|.|||||.|||:.|||:|.|...||
  Fly    62 AGSVSYAAPDGTPIQLEYTADENGYRPTGAHLPTPPPIPDYILKALAYIEAHP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 27/46 (59%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 27/46 (59%)

Return to query results.
Submit another query.