DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr67Fa2

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster


Alignment Length:115 Identity:61/115 - (53%)
Similarity:83/115 - (72%) Gaps:1/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGGYYASGSS 72
            :|||.:||.......:.:.:|.|.|....::: |.:|.||||:|||||||.||.|:||.:|:|..
  Fly     5 MLVASAVLACAYGAATYNQEAGAYITKIGSDI-QPEGNYNYQYETSNGIAAQESGIGGNHANGGF 68

  Fly    73 QYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPE 122
            .:|:|||:|:|::|.|||||:||||..||||.|||.|||:||||.|.||:
  Fly    69 SWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHPQ 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 29/46 (63%)
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 29/46 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470140
Domainoid 1 1.000 70 1.000 Domainoid score I16502
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 1 1.000 - - FOG0014398
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3799
87.850

Return to query results.
Submit another query.