DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr65Ec

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:124 Identity:77/124 - (62%)
Similarity:94/124 - (75%) Gaps:5/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKINVVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGG 65
            |:|..|:.:.|::|.. |||   ||.||.||.|.:.::|| |||.|.||::||||||.||.||||
  Fly     1 MNKFFVLAVAALAVSC-VQA---DSFDARAETREYKSDLK-EDGSYAYQYQTSNGIAGQESGVGG 60

  Fly    66 YYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPEED 124
            ||||||:.||.|:|||||||||||.||:.|.|.|||||.|||.:|||||||.|.||:::
  Fly    61 YYASGSNAYYAPDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIRTHPQQE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 36/46 (78%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 36/46 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470135
Domainoid 1 1.000 70 1.000 Domainoid score I16502
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I7164
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 1 1.000 - - FOG0014398
OrthoInspector 1 1.000 - - mtm9572
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3799
109.900

Return to query results.
Submit another query.