DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Acp65Aa

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:112 Identity:35/112 - (31%)
Similarity:55/112 - (49%) Gaps:19/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKINVVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQED---GIYNYQFETSNGIAQQEQG 62
            |.|:.:||.....:|....|||.:..:        |.|.:.|:   |.|.:.::.|:|.::.|:|
  Fly     1 MMKLMLVVGSIALLLALASARPQNDVE--------VLEYESENTGLGGYKFSYKLSDGTSRTEEG 57

  Fly    63 VGGYYAS--------GSSQYYTPEGQLIQLTYTADENGFQPQGEHLP 101
            |.....:        ||..:..|:||...:.:.||||||||:|.|||
  Fly    58 VVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 15/54 (28%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 15/54 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.