DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Lcp65Ag1

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster


Alignment Length:107 Identity:37/107 - (34%)
Similarity:55/107 - (51%) Gaps:16/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KINVVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG----V 63
            |..:|.:...:|.|...|  ::.|..   :|| .:::..|.  :.|.:|||:|.|.|..|    :
  Fly     2 KFLIVFVALFAVALAAPA--AEEPTI---VRS-ESDVGPES--FKYDWETSDGQAAQAVGQLNDI 58

  Fly    64 G----GYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLP 101
            |    ....|||.::...:||..|:.|.||:|||||||.|||
  Fly    59 GTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 19/54 (35%)
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:306811 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.