DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr49Af

DIOPT Version :10

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:133 Identity:43/133 - (32%)
Similarity:67/133 - (50%) Gaps:26/133 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQE-----DGIYNYQFETSNGIAQQEQGV--- 63
            ::|:|:.|   |.|..:|:.|          .:.||     :|.|:|.:|..:|....:.||   
  Fly     4 LMLIALFV---VAASATDNDD----------PISQESNVEYNGKYHYHYELKDGSKATQDGVLKS 55

  Fly    64 -----GGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPEE 123
                 .|...:|...:...:|:...::|||||||:...|:|||||.|.|.::||:|||.|.||.:
  Fly    56 VNADHNGESVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHPYK 120

  Fly   124 DGE 126
            ..|
  Fly   121 TPE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 15/54 (28%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 15/54 (28%)

Return to query results.
Submit another query.