DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr47Eg

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster


Alignment Length:117 Identity:42/117 - (35%)
Similarity:59/117 - (50%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG-VGG--YYASGS 71
            :|.:.||.|.....|:....||.:..|      || :.|..|..|.:..|::| :.|  :...||
  Fly     5 IAFACLLAVALANEDANVLRAEQQVNV------DG-FAYAVELDNSVNVQQKGDLNGEEWVVKGS 62

  Fly    72 SQYYTPEGQLIQLTYTADENGFQPQGEH--LPTPHPIPEAILKSLEYNRNHP 121
            ..:.:||...:.:.|.||.||:|....:  ||||.||||||.:||||...||
  Fly    63 QSWTSPENVPVSIQYIADANGYQVVSANPPLPTPPPIPEAIQRSLEYIAAHP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 14/49 (29%)
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439275
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.