DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr47Ef

DIOPT Version :10

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:108 Identity:53/108 - (49%)
Similarity:60/108 - (55%) Gaps:15/108 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RPSDSPDA------HAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGGYYAS--------GS 71
            |||.|..|      ...|.||||| ...||.|.:.:||.|||..||:|......|        ||
  Fly   119 RPSPSGGAPPTSGPPIPILSFVNE-NDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGS 182

  Fly    72 SQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSL 114
            ..|..|||:|:::.||||||||.|.|..||||.||||||.|||
  Fly   183 YSYTNPEGELVEIMYTADENGFVPSGNALPTPPPIPEAIAKSL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 23/54 (43%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 23/54 (43%)

Return to query results.
Submit another query.