DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:123 Identity:44/123 - (35%)
Similarity:62/123 - (50%) Gaps:27/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLVAMSVLLGVQARP--------SDSPDAHAEIRSFVNELKQE-----DGIYNYQFETSNGIAQQ 59
            :::|:..|..:||:|        .:|.||:|.|      |||.     ||.|.|.:||||||...
  Fly    11 LVLALCCLSFIQAQPQRGLPPPRGNSFDANAVI------LKQNFDLNPDGSYQYNYETSNGIRAD 69

  Fly    60 EQG--------VGGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEA 109
            |.|        :......||..|..|:|.:..:||.|||||::.:|.|:|||.|:..|
  Fly    70 EAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTITYIADENGYRAEGAHIPTPPPVRAA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 21/54 (39%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439191
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.