DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CG1850

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_610265.1 Gene:CG1850 / 35647 FlyBaseID:FBgn0033154 Length:681 Species:Drosophila melanogaster


Alignment Length:139 Identity:35/139 - (25%)
Similarity:48/139 - (34%) Gaps:38/139 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INVVVLVAMSVLLGVQARPSDSPDAHAEIRS---FVNELKQ-----EDGI-------YNYQFETS 53
            |.::.|.:......::.:|.....|:|..|.   .|:.|.|     .||.       |||. |..
  Fly     6 IGLLALGSARAFSVIRTQPHPQLVAYAPARGEFPVVSGLAQGYVRYYDGTGAERLLPYNYP-EPL 69

  Fly    54 NGIAQQEQGVGGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHL---------PTP------ 103
            |||  ::........||..|    |.|.|.|.....|..:|.....|         |||      
  Fly    70 NGI--RDLSTSSLVRSGEEQ----ESQQIALFRAWCEQRYQAMRVELDRLKAQGLKPTPSMLAQF 128

  Fly   104 HPIPEAILK 112
            .|: |.|:|
  Fly   129 EPL-EQIVK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 15/46 (33%)
CG1850NP_610265.1 GBP_C <452..523 CDD:303769
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.