DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Pcp

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:161 Identity:61/161 - (37%)
Similarity:88/161 - (54%) Gaps:16/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INVVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQE-DGIYNYQFETSNGIAQQEQGVGGYY 67
            :|.:|.:|   :|.|||..|..||:....|:..|:|:.| ||.|.|.:||||||:..::|:||..
  Fly     5 VNFIVALA---VLQVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEGLGGVA 66

  Fly    68 ASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPEEDGEY---EH 129
            ..|.|.|.:|||::|.:.|.|||.|:.|.|.|:|   .:|:.||:||||.|.||.:..:|   |.
  Fly    67 VQGGSSYTSPEGEVISVNYVADEFGYHPVGAHIP---QVPDYILRSLEYIRTHPYQIKDYYTGEL 128

  Fly   130 HDHHHD------HHEHHQSHGQEQGKQYLQP 154
            ....||      :..:.|.|...|.:....|
  Fly   129 KTVEHDAAAFNVYTRNIQDHTIPQSRPSTTP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 22/46 (48%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 22/46 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.