DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and AgaP_AGAP012728

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_560629.5 Gene:AgaP_AGAP012728 / 3292280 VectorBaseID:AGAP012728 Length:207 Species:Anopheles gambiae


Alignment Length:92 Identity:45/92 - (48%)
Similarity:56/92 - (60%) Gaps:10/92 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IRSFVNELKQEDGIYNYQFETSNGIAQQEQG---------VGGYYASGSSQYYTPEGQLIQLTYT 87
            |.|:.|::.. ||.|:|.:.|.:|..||.||         :......||..|.:||||||.:||.
Mosquito    77 ITSYSNDVSY-DGSYSYAYTTGDGQQQQAQGYLKNAGRKDLEAQAVQGSYSYTSPEGQLITVTYI 140

  Fly    88 ADENGFQPQGEHLPTPHPIPEAILKSL 114
            ||||||:.:|.|||||.||||||.|||
Mosquito   141 ADENGFRAEGAHLPTPPPIPEAIQKSL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 23/55 (42%)
AgaP_AGAP012728XP_560629.5 Chitin_bind_4 90..146 CDD:278791 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.