powered by:
Protein Alignment Cpr65Eb and CU01_ANOGA
DIOPT Version :9
Sequence 1: | NP_648076.3 |
Gene: | Cpr65Eb / 38774 |
FlyBaseID: | FBgn0035736 |
Length: | 179 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_551139.2 |
Gene: | CU01_ANOGA / 3290499 |
VectorBaseID: | AGAP001666 |
Length: | 245 |
Species: | Anopheles gambiae |
Alignment Length: | 53 |
Identity: | 15/53 - (28%) |
Similarity: | 24/53 - (45%) |
Gaps: | 5/53 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 YNYQFETSNGIA----QQEQGVGGYYASGSSQYYTPEGQLIQLTYTAD-ENGF 93
|::.:..|:.:. .|::...|....||.....|:|....:.|||| .|||
Mosquito 66 YSFSYGISDALTGDSKSQQESRSGDVVQGSYSVVDPDGTKRTVDYTADPHNGF 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.