DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and CPR27

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_556679.1 Gene:CPR27 / 3290084 VectorBaseID:AGAP006003 Length:123 Species:Anopheles gambiae


Alignment Length:105 Identity:34/105 - (32%)
Similarity:56/105 - (53%) Gaps:30/105 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EIRSFVNELKQEDGIYNYQFETSNGIAQQEQG----------VGGYYASGSSQYYTPEGQLIQLT 85
            ::.|:.| ::.||| |.:.:||.:|.|::|.|          |.|:|:     ||||:|.:.::.
Mosquito    26 DLISYEN-VQTEDG-YRFSYETKDGQAREEVGTIDPGTGVLRVTGWYS-----YYTPDGVMHRVD 83

  Fly    86 YTADENGFQPQGEHLP-------TPH----PIPEAILKSL 114
            :.|||||::.:.|  |       ||:    ||...:|.||
Mosquito    84 FVADENGYRVESE--PSSVQEEFTPNVEAGPIDRTVLLSL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 19/56 (34%)
CPR27XP_556679.1 Chitin_bind_4 39..91 CDD:278791 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.