DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Eb and Cpr12A

DIOPT Version :9

Sequence 1:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:116 Identity:32/116 - (27%)
Similarity:52/116 - (44%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG---------- 62
            :.:..:.|:..|.....:|.|.. :..|.|  :..||.|.|:||..:|.|:.|:|          
  Fly    11 IFLLSATLISAQQIKESAPSARL-LDRFDN--RYPDGSYEYRFELDDGTARYERGYFVKINDVKT 72

  Fly    63 --VGGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHP-IPEAI 110
              |.||||     |...:|:.|.:.|.||:.|::......|..:| :|.:|
  Fly    73 LMVVGYYA-----YRMTDGRYITVFYNADQFGYRQNQSITPQEYPNLPRSI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 19/58 (33%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:278791 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.